PageOverview.com
PageOverview.comAll website entries338383383438349383495
Comprehensive Companydetectleakswaterinriyadh.com website statistics analysis:
Site description: 290 شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من
Website title: شركة كشف تسربات المياه بالرياض (الموقع للايجار
Website Overview: The server, which itself is located in Montreal; Canada, has an IP address 149.56.3.122. Overall there are 0 off-site links on the homepage of the website. Expiration of companydetectleakswaterinriyadh.com will occur on October 5th in 2017. Alexa Global rank for companydetectleakswaterinriyadh.com is 977208. Domain was probably registered on October 5th in 2016. This domain's WHOIS records was updated on December 9th in 2016. The past 3 months resulted in Alexa position shift by -12832 for companydetectleakswaterinriyadh.com.
Known Profiles
Google Plus Account:Not specified at this time
AddThis User:Not specified at this time
Google Analytics:Not specified at this time
Adsense ID:Not specified at this time
Have any insights?
Index in-depth overview
Server region:Montreal; Canada
Site IP address:149.56.3.122
Number of top offsite links
  1. Not specified at this time
Site Whois details
Possible owners:
Expected expiration:October 5th in 2017
Creation date:October 5th in 2016
Unedited Whois text:

Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: COMPANYDETECTLEAKSWATERINRIYADH.COM Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS1.NAKLAFSH.COM Name Server: NS2.NAKLAFSH.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 09-dec-2016 Creation Date: 05-oct-2016 Expiration Date: 05-oct-2017 >>> Last update of whois database: Sat, 27 May 2017 16:25:13 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: companydetectleakswaterinriyadh.com Registrar URL: http://www.godaddy.com Registrant Name: HoStY-HoSt.CoM EG Registrant Organization: HoStY-HoSt.CoM.EG Name Server: NS1.NAKLAFSH.COM Name Server: NS2.NAKLAFSH.COM DNSSEC: unsigned For complete domain details go to: http://who.godaddy.com/whoischeck.aspx?domain=companydetectleakswaterinriyadh.com The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database.

Renew date:December 9th in 2016
How frequently employedTag keywords tableUse denseness
No data yetأحدثNo data yet
No data yetتسربNo data yet
No data yetإصلاحNo data yet
No data yetالسقفNo data yet
No data yetشركةNo data yet
No data yetبالرياضNo data yet
No data yetالمياهNo data yet
No data yetكشفو تسرباتNo data yet
No data yetتسرباتNo data yet
No data yetاجهزةNo data yet
No data yetالرياضNo data yet
No data yetفيNo data yet
No data yetالحماماتNo data yet
No data yetماءNo data yet
No data yetكشف تسربو الماءNo data yet
No data yetبالضمانNo data yet
No data yetإصلاحNo data yet
No data yetافضلNo data yet
No data yetفي الجدارNo data yet
No data yetالرياضNo data yet
No data yetباحدثNo data yet
No data yetكشفNo data yet
No data yetسائلNo data yet
No data yetبدون تكسيرNo data yet
No data yetتسرباتNo data yet
No data yetالمياهNo data yet
Known Alexa ranks data
Rank in target country:No data yet
Alexa stats updated on:November 15th in 2016
Global Alexa rank over the past year
Capacity rating:No data yet
Delta of the rating:-12832
30 day statistics overview
Global ranking:977208
Webpage target country:No data yet
Complementary links
Not specified at this time
Frequent website domain typos:
Server header response:
Accept-Ranges: bytes Vary: Accept-Encoding X-Cache-Status: MISS Content-Length: 15948 Vary: Accept-Encoding Connection: keep-alive Date: Wed, 24 May 2017 17:00:06 GMT Last-Modified: Fri, 07 Oct 2016 19:37:08 GMT HTTP/1.1 200 OK Expires: Wed, 24 May 2017 17:00:07 GMT Pragma: public X-Server-Powered-By: Engintron Server: nginx Cache-Control: public Content-Type: text/html Cache-Control: max-age=1
How safe is the website
Google Safety Rank:No data yet
WOT Safety Evaluation:No data yet
Child Safety by WOT:No data yet
Similar statistics
0.0232 // 2024-04-28 02:26:11
All Rights reserved 2018 © PageOverview.com