PageOverview.com
PageOverview.comAll website entries442424424442441424410
Comprehensive Kindergarten-spitalampyhrn.com website statistics analysis:
Site description: 0 Not specified at this time
Website title: Pfarrcaritas Kindergarten Spital am Pyhrn - pfarrcaritaskiga-spitalampyhrns Webseite!
Website Overview: The server, which itself is located in Dublin; Ireland, has an IP address 52.211.143.189. Overall there are 2 off-site links on the homepage of the website. Expiration of kindergarten-spitalampyhrn.com will occur on May 24th in 2018. Alexa Global rank for kindergarten-spitalampyhrn.com is 377539. Domain was probably registered on May 24th in 2017. This domain's WHOIS records was updated on May 24th in 2017. The past 3 months resulted in Alexa position shift by 0 for kindergarten-spitalampyhrn.com.
Known Profiles
Google Plus Account:Not specified at this time
AddThis User:Not specified at this time
Google Analytics:24231837-95
Adsense ID:Not specified at this time
Have any insights?
Index in-depth overview
Server region:Dublin; Ireland
Site IP address:52.211.143.189
Number of top offsite links
Site Whois details
Associated person phone number:
  1. +49.94159559482
Expected expiration:May 24th in 2018
Creation date:May 24th in 2017
Unedited Whois text:

Domain Name: KINDERGARTEN-SPITALAMPYHRN.COM Registry Domain ID: 2127418185_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.psi-usa.info Registrar URL: http://www.psi-usa.info Updated Date: 2017-05-24T10:51:45Z Creation Date: 2017-05-24T10:51:45Z Registry Expiry Date: 2018-05-24T10:51:45Z Registrar: PSI-USA, Inc. dba Domain Robot Registrar IANA ID: 151 Registrar Abuse Contact Email: Email profile not revealed Registrar Abuse Contact Phone: +49.94159559482 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS1.JIMDO.COM Name Server: NS2.JIMDO.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2018-02-04T13:40:48Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.

Renew date:May 24th in 2017
How frequently employedTag keywords tableUse denseness
No data yetNo data yetNo data yet
Known Alexa ranks data
Rank in target country:No data yet
Alexa stats updated on:January 31st in 2018
Global Alexa rank over the past year
Capacity rating:No data yet
Delta of the rating:0
30 day statistics overview
Global ranking:377539
Webpage target country:No data yet
Complementary links
Not specified at this time
Frequent website domain typos:
Server header response:
Content-Type: text/html; charset=UTF-8 Date: Mon, 12 Feb 2018 01:49:28 GMT X-RateLimit-Reset: 0 Connection: keep-alive Vary: Accept-Encoding X-RateLimit-Remaining: 0 HTTP/1.1 200 OK X-RateLimit-Limit: 0 Cache-Control: no-cache, no-store, must-revalidate X-Jimdo-Wid: s866e515be3556e64 Transfer-Encoding: chunked X-Jimdo-Instance: i-0253b72c38125f989 Server: nginx Strict-Transport-Security: max-age=604800
How safe is the website
Google Safety Rank:No data yet
WOT Safety Evaluation:No data yet
Child Safety by WOT:No data yet
Similar statistics
0.0213 // 2024-05-15 13:36:11
All Rights reserved 2018 © PageOverview.com