PageOverview.com
PageOverview.comAll website entries663638638263827638277
Comprehensive Modernfamilynightlysweepstakes.com website statistics analysis:
Site description: 97 Enter for a chance to win a trip to Hollywood, California, and attend a Modern Family table read!
Website title: Modern Family Hollywood Here I Come Sweepstakes
Website Overview: The server, which itself is located in No data yet, has an IP address 159.135.22.126. Overall there are 1 off-site links on the homepage of the website. Expiration of modernfamilynightlysweepstakes.com will occur on August 8th in 2017. Alexa Global rank for modernfamilynightlysweepstakes.com is 951415. Domain was probably registered on August 8th in 2014. This domain's WHOIS records was updated on July 8th in 2016. The past 3 months resulted in Alexa position shift by -27283 for modernfamilynightlysweepstakes.com.
Known Profiles
Google Plus Account:Not specified at this time
AddThis User:Not specified at this time
Google Analytics:31504323-12
Adsense ID:Not specified at this time
Have any insights?
Index in-depth overview
Server region:No data yet
Site IP address:159.135.22.126
Number of top offsite links
Site Whois details
Associated person phone number:
  1. +1.2083895740
Possible owners:
Possible owner address:
  1. p.o. box 900,
Expected expiration:August 8th in 2017
Creation date:August 8th in 2014
Unedited Whois text:

Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: MODERNFAMILYNIGHTLYSWEEPSTAKES.COM Registrar: MARKMONITOR INC. Sponsoring Registrar IANA ID: 292 Whois Server: whois.markmonitor.com Referral URL: http://www.markmonitor.com Name Server: DNS1.STABLETRANSIT.COM Name Server: DNS2.STABLETRANSIT.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 08-jul-2016 Creation Date: 08-aug-2014 Expiration Date: 08-aug-2017 >>> Last update of whois database: Fri, 14 Apr 2017 04:38:37 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: modernfamilynightlysweepstakes.com Registry Domain ID: 1870313490_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.markmonitor.com Registrar URL: http://www.markmonitor.com Updated Date: 2016-07-08T02:07:57-0700 Creation Date: 2014-08-08T15:21:59-0700 Registrar Registration Expiration Date: 2017-08-08T00:00:00-0700 Registrar: MarkMonitor, Inc. Registrar IANA ID: 292 Registrar Abuse Contact Email: Email profile not revealed Registrar Abuse Contact Phone: +1.2083895740 Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited) Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited) Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited) Registry Registrant ID: Registrant Name: Intellectual Property Department Registrant Organization: Twentieth Century Fox Film Corporation Registrant Street: P.O. Box 900, Registrant City: Beverly Hills Registrant State/Province: CA Registrant Postal Code: 90213-0900 Registrant Country: US Registrant Phone: +1.3103691000 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Email profile not revealed Registry Admin ID: Admin Name: Intellectual Property Department Admin Organization: Twentieth Century Fox Film Corporation Admin Street: P.O. Box 900, Admin City: Beverly Hills Admin State/Province: CA Admin Postal Code: 90213-0900 Admin Country: US Admin Phone: +1.3103691000 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Email profile not revealed Registry Tech ID: Tech Name: Intellectual Property Department Tech Organization: Twentieth Century Fox Film Corporation Tech Street: P.O. Box 900, Tech City: Beverly Hills Tech State/Province: CA Tech Postal Code: 90213-0900 Tech Country: US Tech Phone: +1.3103691000 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Email profile not revealed Name Server: dns2.stabletransit.com Name Server: dns1.stabletransit.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2017-04-13T21:38:57-0700 <<< The Data in MarkMonitor.com's WHOIS database is provided by MarkMonitor.com for information purposes, and to assist persons in obtaining information about or related to a domain name registration record. MarkMonitor.com does not guarantee its accuracy. By submitting a WHOIS query, you agree that you will use this Data only for lawful purposes and that, under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail (spam); or (2) enable high volume, automated, electronic processes that apply to MarkMonitor.com (or its systems). MarkMonitor.com reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. MarkMonitor is the Global Leader in Online Brand Protection. MarkMonitor Domain Management(TM) MarkMonitor Brand Protection(TM) MarkMonitor AntiPiracy(TM) MarkMonitor AntiFraud(TM) Professional and Managed Services Visit MarkMonitor at http://www.markmonitor.com Contact us at +1.8007459229 In Europe, at +44.02032062220 For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Renew date:July 8th in 2016
How frequently employedTag keywords tableUse denseness
No data yetNo data yetNo data yet
Known Alexa ranks data
Rank in target country:No data yet
Alexa stats updated on:October 4th in 2017
Global Alexa rank over the past year
Capacity rating:No data yet
Delta of the rating:-27283
30 day statistics overview
Global ranking:951415
Webpage target country:No data yet
Complementary links
Not specified at this time
Frequent website domain typos:
Server header response:
Date: Mon, 12 Jun 2017 19:12:52 GMT X-Powered-By: ASP.NET X-AspNet-Version: 4.0.30319 Set-Cookie: X-Mapping-lgdkfegg=6BE9AB5F9E84B24C569BBD3444A877F8; path=/ HTTP/1.1 200 OK Content-Length: 3231 Cache-Control: private Server: Microsoft-IIS/8.5 Content-Type: text/html; charset=utf-8
How safe is the website
Google Safety Rank:No data yet
WOT Safety Evaluation:No data yet
Child Safety by WOT:No data yet
Similar statistics
0.0232 // 2024-05-11 23:56:45
All Rights reserved 2018 © PageOverview.com