Known Profiles | |
---|---|
Google Plus Account: | Not specified at this time |
AddThis User: | Not specified at this time |
Google Analytics: | 88171084-1 |
Adsense ID: | Not specified at this time |
Domain nameservers | ||
---|---|---|
212.67.202.2 | ns.123-reg.co.uk | United Kingdom |
62.138.132.21 | ns2.123-reg.co.uk | Hoest; Germany |
Have any insights? |
---|
Index in-depth overview | |
---|---|
Server region: | Dublin; Ireland |
Site IP address: | 54.171.1.43 |
Number of top offsite links | |
|
Site Whois details | |
---|---|
Renew date: | February 15th in 2018 |
Unedited Whois text: | |
Error for "pheaseyparkfarmchildrenscentrenursery.co.uk". the WHOIS query quota for Email profile not revealed has been exceeded and will be replenished in 56 seconds WHOIS lookup made at 15:24:23 12-Feb-2018 -- This WHOIS information is provided for free by Nominet UK the central registry for .uk domain names. This information and the .uk WHOIS are: Copyright Nominet UK 1996 - 2018. You may not access the .uk WHOIS or use any data from it except as permitted by the terms of use available in full at http://www.nominet.uk/whoisterms, which includes restrictions on: (A) use of the data for advertising, or its repackaging, recompilation, redistribution or reuse (B) obscuring, removing or hiding any or all of this notice and (C) exceeding query rate or volume limits. The data is provided on an 'as-is' basis and may lag behind the register. Access may be withdrawn or restricted at any time. | |
Expected expiration: | No data yet |
Creation date: | No data yet |
How frequently employed | Tag keywords table | Use denseness |
---|---|---|
No data yet | Home | No data yet |
No data yet | Pheasey Park Farm | No data yet |
No data yet | Education | No data yet |
No data yet | Children's Centre Nursery | No data yet |
Known Alexa ranks data | |
---|---|
Rank in target country: | No data yet |
Alexa stats updated on: | June 1st in 2018 |
Global Alexa rank over the past year | |
Capacity rating: | No data yet |
Delta of the rating: | +196960 |
30 day statistics overview | |
Global ranking: | 744820 |
Webpage target country: | No data yet |
Complementary links | |
Not specified at this time |
Server header response: |
---|
Set-Cookie: hs=-257059143;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;HttpOnly
X-Wix-Request-Id: 1519565755.62631446020453025757
X-Wix-Renderer-Server: app-jvm-21-0.84.wixprod.net
transfer-encoding: chunked
Content-Language: en
Expires: -1
X-Wix-Server-Artifact-Id: wix-public-war
HTTP/1.1 200 OK
Cache-Control: no-cache
X-Seen-By: BTnOiHJfychu5uLth4+AW8dGeYGpVyoUSMKAdIe0cbQ=,1wy2ILu/S4rlWT/R4rqCrVbmXE/o2wHC/BXzSPnkxYo=,LwsIp90Tma5sliyMxJYVEthWsKYOO1+wUWoDHg6PvM5YgeUJqUXtid+86vZww+nL,I2ZOrNA1LIowGTY6Ll7mx/ayVZxVTGytySOSc+GvWuU=,1wy2ILu/S4rlWT/R4rqCrV/JMDd4gilr2uGoEO7PurY=,Tw2AanFDQ+Wwo8Xxk6ZL7rHKeAJXtkPxqn+uc4aMlODq6NNL91a3Di10jVZVVuAn
Connection: keep-alive
Set-Cookie: XSRF-TOKEN=1519565755|CqBnzboS01dn;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk
ETag: 56621063678c190c3b8324b756765260
Content-Type: text/html;charset=utf-8
Pragma: no-cache
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: User-Agent
Date: Sun, 25 Feb 2018 13:35:55 GMT
Server: Pepyaka/1.13.7
Set-Cookie: svSession=b91fb7c705896492b6ed09768c84fe788d91c80dec74df47446667470a1e978464319bcbde51360b8952738a9518cd8a1e60994d53964e647acf431e4f798bcde6ab34b9f79743876d05d25e4f19fbd877016759ad92bf6be599c6d8e3f58f35;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;Expires=Tue, 25-Feb-2020 13:35:54 GMT
|
How safe is the website | |
---|---|
Google Safety Rank: | No data yet |
WOT Safety Evaluation: | No data yet |
Child Safety by WOT: | No data yet |