PageOverview.com
PageOverview.comAll website entries660603603760378603780
Comprehensive Pheaseyparkfarmchildrenscentrenursery.co.uk website statistics analysis:
Site description: 159 Our Vision is to develop a learning community where all children enthusiastically participate, excel and are proud of their achievements across the curriculum.
Website title: Pheasey Park Farm Childrens Centre Nursery
Website Overview: This domain's WHOIS records was updated on February 15th in 2018. The server, which itself is located in Dublin; Ireland, has an IP address 54.171.1.43. The past 3 months resulted in Alexa position shift by +196960 for pheaseyparkfarmchildrenscentrenursery.co.uk. Overall there are 0 off-site links on the homepage of the website. At this time, our database holds no entry of registration date. Alexa Global rank for pheaseyparkfarmchildrenscentrenursery.co.uk is 744820.
Known Profiles
Google Plus Account:Not specified at this time
AddThis User:Not specified at this time
Google Analytics:88171084-1
Adsense ID:Not specified at this time
Domain nameservers
212.67.202.2ns.123-reg.co.ukUnited Kingdom
62.138.132.21ns2.123-reg.co.ukHoest; Germany
Have any insights?
Index in-depth overview
Server region:Dublin; Ireland
Site IP address:54.171.1.43
Number of top offsite links
  1. Not specified at this time
Site Whois details
Renew date:February 15th in 2018
Unedited Whois text:

Error for "pheaseyparkfarmchildrenscentrenursery.co.uk". the WHOIS query quota for Email profile not revealed has been exceeded and will be replenished in 56 seconds WHOIS lookup made at 15:24:23 12-Feb-2018 -- This WHOIS information is provided for free by Nominet UK the central registry for .uk domain names. This information and the .uk WHOIS are: Copyright Nominet UK 1996 - 2018. You may not access the .uk WHOIS or use any data from it except as permitted by the terms of use available in full at http://www.nominet.uk/whoisterms, which includes restrictions on: (A) use of the data for advertising, or its repackaging, recompilation, redistribution or reuse (B) obscuring, removing or hiding any or all of this notice and (C) exceeding query rate or volume limits. The data is provided on an 'as-is' basis and may lag behind the register. Access may be withdrawn or restricted at any time.

Expected expiration:No data yet
Creation date:No data yet
How frequently employedTag keywords tableUse denseness
No data yetHomeNo data yet
No data yetPheasey Park FarmNo data yet
No data yetEducationNo data yet
No data yetChildren's Centre NurseryNo data yet
Known Alexa ranks data
Rank in target country:No data yet
Alexa stats updated on:June 1st in 2018
Global Alexa rank over the past year
Capacity rating:No data yet
Delta of the rating:+196960
30 day statistics overview
Global ranking:744820
Webpage target country:No data yet
Complementary links
Not specified at this time
Frequent website domain typos:
Server header response:
Set-Cookie: hs=-257059143;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;HttpOnly X-Wix-Request-Id: 1519565755.62631446020453025757 X-Wix-Renderer-Server: app-jvm-21-0.84.wixprod.net transfer-encoding: chunked Content-Language: en Expires: -1 X-Wix-Server-Artifact-Id: wix-public-war HTTP/1.1 200 OK Cache-Control: no-cache X-Seen-By: BTnOiHJfychu5uLth4+AW8dGeYGpVyoUSMKAdIe0cbQ=,1wy2ILu/S4rlWT/R4rqCrVbmXE/o2wHC/BXzSPnkxYo=,LwsIp90Tma5sliyMxJYVEthWsKYOO1+wUWoDHg6PvM5YgeUJqUXtid+86vZww+nL,I2ZOrNA1LIowGTY6Ll7mx/ayVZxVTGytySOSc+GvWuU=,1wy2ILu/S4rlWT/R4rqCrV/JMDd4gilr2uGoEO7PurY=,Tw2AanFDQ+Wwo8Xxk6ZL7rHKeAJXtkPxqn+uc4aMlODq6NNL91a3Di10jVZVVuAn Connection: keep-alive Set-Cookie: XSRF-TOKEN=1519565755|CqBnzboS01dn;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk ETag: 56621063678c190c3b8324b756765260 Content-Type: text/html;charset=utf-8 Pragma: no-cache Expires: Thu, 01 Jan 1970 00:00:00 GMT Vary: User-Agent Date: Sun, 25 Feb 2018 13:35:55 GMT Server: Pepyaka/1.13.7 Set-Cookie: svSession=b91fb7c705896492b6ed09768c84fe788d91c80dec74df47446667470a1e978464319bcbde51360b8952738a9518cd8a1e60994d53964e647acf431e4f798bcde6ab34b9f79743876d05d25e4f19fbd877016759ad92bf6be599c6d8e3f58f35;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;Expires=Tue, 25-Feb-2020 13:35:54 GMT
How safe is the website
Google Safety Rank:No data yet
WOT Safety Evaluation:No data yet
Child Safety by WOT:No data yet
Similar statistics
0.0195 // 2024-05-09 20:34:35
All Rights reserved 2018 © PageOverview.com