PageOverview.com
PageOverview.comAll website entries116161161016109161090
Comprehensive Srisubrahmanyaswamydevalayamskandagiri.org website statistics analysis:
Site description: 0 Not specified at this time
Website title: .:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
Website Overview: The server, which itself is located in Hyderabad; India, has an IP address 103.24.202.75. Overall there are 1 off-site links on the homepage of the website. Expiration of srisubrahmanyaswamydevalayamskandagiri.org will occur on April 29th in 2018. Alexa Global rank for srisubrahmanyaswamydevalayamskandagiri.org is 947874. Domain was probably registered on April 29th in 2011. This domain's WHOIS records was updated on April 12th in 2017. The past 3 months resulted in Alexa position shift by +4123 for srisubrahmanyaswamydevalayamskandagiri.org.
Known Profiles
Google Plus Account:Not specified at this time
AddThis User:Not specified at this time
Google Analytics:Not specified at this time
Adsense ID:Not specified at this time
Domain nameservers
103.24.203.2ns1.outline.co.inNetherlands
103.24.203.3ns2.outline.co.inNetherlands
Have any insights?
Index in-depth overview
Server region:Hyderabad; India
Site IP address:103.24.202.75
Number of top offsite links
Site Whois details
Associated person phone number:
  1. +1.2013775952
Possible owners:
Possible owner address:
  1. flat no: 608, taj enclave
  2. lakdikapool
Expected expiration:April 29th in 2018
Creation date:April 29th in 2011
Unedited Whois text:

Domain Name: SRISUBRAHMANYASWAMYDEVALAYAMSKANDAGIRI.ORG Registry Domain ID: D162151921-LROR Registrar WHOIS Server: Registrar URL: http://www.PublicDomainRegistry.com Updated Date: 2017-04-12T04:37:57Z Creation Date: 2011-04-29T14:24:28Z Registry Expiry Date: 2018-04-29T14:24:28Z Registrar Registration Expiration Date: Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Registrar Abuse Contact Email: Email profile not revealed Registrar Abuse Contact Phone: +1.2013775952 Reseller: Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: C137364795-LROR Registrant Name: Outline Designs Registrant Organization: Outline Designs Registrant Street: Flat No: 608, taj enclave Registrant Street: Lakdikapool Registrant City: Hyderabad Registrant State/Province: Andhra Pradesh Registrant Postal Code: 500004 Registrant Country: IN Registrant Phone: +91.04064538777 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Email profile not revealed Registry Admin ID: C137364795-LROR Admin Name: Outline Designs Admin Organization: Outline Designs Admin Street: Flat No: 608, taj enclave Admin Street: Lakdikapool Admin City: Hyderabad Admin State/Province: Andhra Pradesh Admin Postal Code: 500004 Admin Country: IN Admin Phone: +91.04064538777 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Email profile not revealed Registry Tech ID: C137364795-LROR Tech Name: Outline Designs Tech Organization: Outline Designs Tech Street: Flat No: 608, taj enclave Tech Street: Lakdikapool Tech City: Hyderabad Tech State/Province: Andhra Pradesh Tech Postal Code: 500004 Tech Country: IN Tech Phone: +91.04064538777 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Email profile not revealed Name Server: NS1.OUTLINE.CO.IN Name Server: NS2.OUTLINE.CO.IN DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2017-05-14T21:03:03Z <<< For more information on Whois status codes, please visit https://icann.org/epp Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Renew date:April 12th in 2017
How frequently employedTag keywords tableUse denseness
No data yetNo data yetNo data yet
Known Alexa ranks data
Rank in target country:No data yet
Alexa stats updated on:May 21st in 2018
Global Alexa rank over the past year
Capacity rating:No data yet
Delta of the rating:+4123
30 day statistics overview
Global ranking:947874
Webpage target country:No data yet
Complementary links
Not specified at this time
Frequent website domain typos:
Server header response:
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Set-Cookie: PHPSESSID=fe0186776d7f95d03dbe6a0128fee853; path=/ Date: Sun, 21 May 2017 00:24:37 GMT X-Powered-By: PHP/5.6.27 HTTP/1.1 200 OK Expires: Thu, 19 Nov 1981 08:52:00 GMT Server: Apache Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Pragma: no-cache
How safe is the website
Google Safety Rank:No data yet
WOT Safety Evaluation:No data yet
Child Safety by WOT:No data yet
Similar statistics
0.0222 // 2024-05-07 12:45:30
All Rights reserved 2018 © PageOverview.com