PageOverview.com
PageOverview.comAll website entries772724724272423724234
Comprehensive Ankaraevdenevenakliyatfirmalari.com website statistics analysis:
Site description: 151 Ankara nakliyat rehberi. Ankara Evden Eve Nakliye Firmalarının Ankara ilçelerine göre listelendiği nakliye rehberi. Ankara ev taşıma firmaları.
Website title: Ankara Nakliyat Rehberi, Ankara Evden Eve Nakliyat Firmaları
Website Overview: The server, which itself is located in Turkey, has an IP address 88.255.89.173. Overall there are 3 off-site links on the homepage of the website. Expiration of ankaraevdenevenakliyatfirmalari.com will occur on June 14th in 2017. Alexa Global rank for ankaraevdenevenakliyatfirmalari.com is 968959. Domain was probably registered on June 14th in 2011. This domain's WHOIS records was updated on June 14th in 2016. The past 3 months resulted in Alexa position shift by +13208 for ankaraevdenevenakliyatfirmalari.com.
Known Profiles
Google Plus Account:Not specified at this time
AddThis User:Not specified at this time
Google Analytics:Not specified at this time
Adsense ID:Not specified at this time
Have any insights?
Index in-depth overview
Server region:Turkey
Site IP address:88.255.89.173
Number of top offsite links
Site Whois details
Renew date:June 14th in 2016
Unedited Whois text:

Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: ANKARAEVDENEVENAKLIYATFIRMALARI.COM Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM Sponsoring Registrar IANA ID: 303 Whois Server: whois.PublicDomainRegistry.com Referral URL: http://www.publicdomainregistry.com Name Server: NS3.REHBERHOST.NET Name Server: NS4.REHBERHOST.NET Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Updated Date: 14-jun-2016 Creation Date: 14-jun-2011 Expiration Date: 14-jun-2017 >>> Last update of whois database: Thu, 25 May 2017 04:17:26 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.

Expected expiration:June 14th in 2017
Creation date:June 14th in 2011
How frequently employedTag keywords tableUse denseness
No data yetNo data yetNo data yet
Known Alexa ranks data
Rank in target country:No data yet
Alexa stats updated on:May 29th in 2016
Global Alexa rank over the past year
Capacity rating:No data yet
Delta of the rating:+13208
30 day statistics overview
Global ranking:968959
Webpage target country:No data yet
Complementary links
Not specified at this time
Frequent website domain typos:
Server header response:
Expires: Thu, 19 Nov 1981 08:52:00 GMT Content-Type: text/html Transfer-Encoding: chunked Server: Vary: Accept-Encoding,User-Agent Date: Tue, 27 Jun 2017 02:01:27 GMT Pragma: no-cache HTTP/1.1 200 OK Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Set-Cookie: PHPSESSID=16c3f4856d760c3f307dc6a8beb2cbb7; path=/ X-Powered-By: PHP/5.4.40
How safe is the website
Google Safety Rank:No data yet
WOT Safety Evaluation:No data yet
Child Safety by WOT:No data yet
Similar statistics
0.0193 // 2024-05-16 19:22:22
All Rights reserved 2018 © PageOverview.com